LC-MS/MS is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-01-17. Where a claim depends on a specific study, the study is described rather than over-claimed.
In laboratory settings, SR9009 is commonly identified by its molecular structure and its interaction with REV-ERB receptors. Vendors may list it under synonyms such as Stenabolic or REV-ERB agonist, but those names do not define purity or identity. Analytical confirmation typically uses high-performance liquid chromatography with ultraviolet detection or liquid chromatography–mass spectrometry. A reference standard is needed to compare retention time and mass spectrum, because the compound can be confused with related research chemicals.
Handling practices for SR9009 focus on minimizing degradation and contamination. The solid is generally stored desiccated at or below -20 °C, protected from light and moisture. Stock solutions are often prepared in dimethyl sulfoxide or ethanol, then aliquoted to avoid repeated freeze–thaw cycles. Aqueous solubility is low, so formulations for animal studies may require cosolvents or suspending agents. Personnel should follow institutional chemical safety procedures, because toxicological data for humans are incomplete.
Regulatory treatment of SR9009 reflects its investigational status. The compound has no approved human therapeutic indication, and sports authorities prohibit its use. It appears on anti-doping lists as a non-approved substance or metabolic modulator, depending on the list version. Products sold online as research chemicals are not quality-controlled medicines, so their identity and purity can differ from the label. Such products may also contain unlisted compounds, which complicates both testing and safety assessment.
Scientific discussion of SR9009 often separates animal evidence from human anecdote. Rodent studies provide controlled data on endurance, metabolism, and gene expression, but they use specific strains, doses, and treatment durations. Human reports are mostly uncontrolled and cannot establish cause and effect. Open questions include oral bioavailability, tissue distribution, metabolic stability, and long-term effects. Review articles generally call for more rigorous pharmacokinetic and safety research before any clinical use could be considered.
Analytical methods for SR9009 typically rely on liquid chromatography coupled with tandem mass spectrometry. The technique can separate the parent compound from related substances and detect low concentrations in biological matrices. Urine and blood are common samples in anti-doping testing, while in vitro studies may use cell culture media. Rapid metabolism and low expected concentrations make method validation important for reliable identification. Exact metabolite patterns can vary by species and are not fully mapped.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white solid | Visual inspection is not sufficient for identity. |
| Solubility | Soluble in DMSO and ethanol | Low solubility in water. |
| Typical storage | -20 °C, desiccated, dark | Protect from repeated temperature changes. |
| Common analytical method | LC-MS or HPLC-UV | Reference standard required for comparison. |
| Common synonyms | SR9009; Stenabolic; REV-ERB agonist | Vendor naming may vary. |
Detection in biological samples can be complicated by rapid metabolism and low circulating concentrations. Some studies report phase I and phase II metabolites, and analytical methods may need to target those species in addition to the parent compound. Immunoassays are not broadly available, so mass spectrometry remains the main confirmatory approach. For anti-doping testing, laboratories look for SR9009 and its metabolites using validated LC-MS methods. Open questions include how long metabolites remain detectable and how different routes of administration alter detection windows.
In laboratory settings, SR9009 is typically characterized by liquid chromatography–mass spectrometry (LC-MS) or high-performance liquid chromatography with ultraviolet detection (HPLC-UV). These methods can confirm identity and estimate purity, but they require reference standards for accurate quantification. Because SR9009 is not a licensed pharmaceutical, no harmonized pharmacopeial monograph exists. Laboratories often validate in-house methods for matrices such as plasma, urine, or cell culture media. Sample preparation may involve protein precipitation or liquid-liquid extraction before analysis.
Physicochemical behavior influences handling. SR9009 is described as a solid with limited aqueous solubility, so organic solvents such as dimethyl sulfoxide or ethanol are common in research stock solutions. Aqueous dilution can produce precipitates if the organic content is too low. Light, heat, and repeated freeze-thaw cycles may affect stability. Storage recommendations usually specify a desiccated freezer environment protected from light, but exact stability data depend on the formulation and matrix.
Regulatory agencies have not approved SR9009 for human therapeutic use. It is typically sold as a research chemical with labels stating that it is not for human consumption. The World Anti-Doping Agency prohibits the substance in sport, generally under the category of non-approved substances. Customs and national laws may restrict importation, sale, or possession. Product quality and legal status can vary by country and vendor, and therapeutic claims are not permitted in regulated advertising because the compound lacks approval.
Several misconceptions surround SR9009. It is often described as a SARM, a steroid, or an exercise pill, but its known target is the REV-ERB receptor family. Rodent studies have examined exercise capacity and metabolic markers, yet human outcomes remain unproven. Oral bioavailability appears low in animals, and human pharmacokinetics are not well characterized. Online products may contain impurities or different compounds, so identity and purity testing are important for research use.
SR9009 is not approved as a medicine by major regulatory agencies. It is commonly sold as a research chemical, a category that may fall outside customary drug approval and quality rules. In sports, the World Anti-Doping Agency lists SR9009 as a prohibited substance. Athletes who use it can face sanctions if it is detected in a sample. Legal status varies by country, and importation may be restricted. Enforcement practices differ across borders.
Detection of SR9009 in biological samples usually employs liquid chromatography coupled with tandem mass spectrometry. This method can identify the parent compound and sometimes metabolites in urine or blood. Because exposure can be low and clearance may be rapid, sample timing and limits of detection matter. Laboratories validate assays for sensitivity and specificity. Results are interpreted alongside chain-of-custody and quality-control records. Urine is the common matrix for anti-doping analysis, while blood may be used in research settings.
Detection of SR9009 in biological samples usually relies on liquid chromatography coupled to tandem mass spectrometry. This approach separates the compound from matrix components and identifies it by mass transitions. Because SR9009 can undergo metabolism, laboratories often look for both parent drug and specific metabolites. Sample preparation may involve protein precipitation or solid-phase extraction. Method validation examines sensitivity, carryover, and interference from related substances, and reference standards are required for accurate calibration.
Storage recommendations for SR9009 reference material typically specify a freezer at -20 °C or lower, with protection from moisture and light. Repeated freeze-thaw cycles can degrade small molecules and introduce variability. Stock solutions in dimethyl sulfoxide are often aliquoted to avoid repeated handling. Stability studies may examine degradation under heat, humidity, and light exposure. The compound's thiophene and nitro groups can participate in reactions that alter analytical signals over time, so such changes affect quantitative results.
Quality control for research materials includes identity confirmation by nuclear magnetic resonance and purity assessment by high-performance liquid chromatography. Mass spectrometry provides molecular weight confirmation and can detect related impurities. Purchasers should request a certificate of analysis that lists lot-specific data. Online products advertised for human use often lack such documentation. Distinguishing legitimate research material from mislabeled or contaminated samples is a recurring challenge in independent testing, and independent laboratories may use orthogonal methods to verify identity.
Most clinical antibiotics were found during the "golden age of antibiotics" (1940s–1960s). Actinomycin was the first antibiotic isolated from Streptomyces in 1940, followed by streptomycin three years later. Antibiotics from Streptomyces isolates (including various aminoglycosides) would go on to comprise over two-thirds of all marketed antibiotics. Streptomyces-derived antibiotics include: Clavulanic acid (Streptomyces clavuligerus) is used in combination with some antibiotics (such as amoxicillin) to weaken bacterial-resistance. Novel anti-infectives being developed include the guadinomines (from Streptomyces sp. K01-0509), inhibitors of the type III secretion system. Non-Streptomyces actinomycetes, filamentous fungi, and non-filamentous bacteria, have also yielded important antibiotics. Nystatin (Streptomyces noursei), amphotericin B (Streptomyces nodosus), ossamycin (Streptomyces hygroscopicus), and natamycin (Streptomyces natalensis) are antifungals isolated from Streptomyces.
The Department was founded in 1934 in Kazan Teachers’ Institute to educate future teachers of chemistry. In November, 2011 the Department of Chemical Education became a structural unit of A. M. Butlerov Institute of Chemistry of Kazan (Volga Region) Federal University. Educational research was combined with fundamental and applied research in chemistry. International, All-Russian and regional research-to-practice conferences on chemical education organized by the Department are of the utmost interest. The Department has received letters of gratitude from school principals for instructing students in research and methodology in their preparation for teaching practice. Today 3 Doctors of Science and 5 Doctors of Philosophy are involved in the educational and bringing-up process at the Department. Since 2010 teachers have been retrained in the field of “Teacher of Chemistry”.The head of the Department is Suria I. Gilmanshina, Doctor of Philosophy in Chemistry, Doctor of Science in Education. The Department conducts research in the following fields:
HA (aq) + H2O (l) ⇌ H3O+ (aq) + A− (aq) Ka Common examples of monoprotic acids in mineral acids include hydrochloric acid (HCl) and nitric acid (HNO3). On the other hand, for organic acids the term mainly indicates the presence of one carboxylic acid group and sometimes these acids are known as monocarboxylic acid. Examples in organic acids include formic acid (HCOOH), acetic acid (CH3COOH) and benzoic acid (C6H5COOH). Polyprotic acids, also known as polybasic acids, are able to donate more than one proton per acid molecule, in contrast to monoprotic acids that only donate one proton per molecule. Specific types of polyprotic acids have more specific names, such as diprotic (or dibasic) acid (two potential protons to donate), and triprotic (or tribasic) acid (three potential protons to donate). Some macromolecules such as proteins and nucleic acids can have a very large number of acidic protons. A diprotic acid (here symbolized by H2A) can undergo one or two dissociations depending on the pH. Each dissociation has its own dissociation constant, Ka1 and Ka2.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
A skeletal survey is useful to confirm the diagnosis of achondroplasia. The skull is large, with a narrow foramen magnum, and relatively small skull base. The vertebral bodies are short and flattened with relatively large intervertebral disk height, and there is congenitally narrowed spinal canal. The iliac wings are small and squared, with a narrow sciatic notch and horizontal acetabular roof. The tubular bones are short and thick with metaphyseal cupping and flaring and irregular growth plates. Fibular overgrowth is present. The hand is broad with short metacarpals and phalanges, and a trident configuration. The ribs are short with cupped anterior ends. If the radiographic features are not classic, a search for a different diagnosis should be entertained. Because of the extremely deformed bone structure, people with achondroplasia are often "double jointed". The diagnosis can be made by fetal ultrasound by progressive discordance between the short femur length and biparietal diameter by age. The trident hand configuration can be seen if the fingers are fully extended. Another common characteristic of the syndrome is thoracolumbar gibbus in infancy.
An ion-exchange membrane is a semi-permeable membrane that transports certain dissolved ions, while blocking other ions or neutral molecules. Ion-exchange membranes are therefore electrically conductive. They are often used in desalination and chemical recovery applications, moving ions from one solution to another with little passage of water. Important examples of ion-exchange membranes include the proton-exchange membranes, that transport H+ cations, and the anion exchange membranes used in certain alkaline fuel cells to transport OH− anions.
An antitoxin is an antibody with the ability to neutralize a specific toxin. Antitoxins are produced by certain animals, plants, and bacteria in response to toxin exposure. Although they are most effective in neutralizing toxins, they can also kill bacteria and other microorganisms. Antitoxins are made within organisms, and can be injected into other organisms, including humans, to treat an infectious disease. This procedure involves injecting an animal with a safe amount of a particular toxin. The animal's body then makes the antitoxin needed to neutralize the toxin. Later, blood is withdrawn from the animal. When the antitoxin is obtained from the blood, it is purified and injected into a human or other animal, inducing temporary passive immunity. To prevent serum sickness, it is often best to use an antitoxin obtained from the same species (e.g. use human antitoxin to treat humans). Most antitoxin preparations are prepared from donors with high titers of antibody against the toxin, making them hyperimmune globulins.
miR-324-5p is a microRNA that functions in cell growth, apoptosis, cancer, epilepsy, neuronal differentiation, psychiatric conditions, cardiac disease pathology, and more. As a microRNA, it regulates gene expression through targeting mRNAs. Additionally, miR-324-5p is both an intracellular miRNA, meaning it is commonly found within the microenvironment of the cell, and one of several circulating miRNAs found throughout the body. Its presence throughout the body both within and external to cells may contribute to miR-324-5p's wide array of functions and role in numerous disease pathologies – especially cancer – in various organ systems.
When connecting the monosaccharides, the oligosaccharides need to be reducing in order to sequentially connect the glycosyl units. The monosaccharides, in nature prefer ɑ-linkages due to anomeric effect, but the disaccharides with ɑ-linkages are non-reducing thus deactivating the consequent connection of the monosaccharides. In order to make the process of glycosylation continuous and automated, the glycosidic linkages must maintain beta so to keep the structure open to coupling with more glycosyl groups. It is somewhat more difficult to prepare 1, 2-cis-β-glycosidic linkages stereoselectively. Typically, when non-participating groups on O-2 position, 1, 2-cis-β-linkage can be achieved either by using the historically important halide ion methods, or by using 2-O-alkylated glycosyl donors, commonly thioglycosides or trichloroacetimidates, in nonpolar solvents. In the early 1990s, it was still the case that the beta mannoside linkage was too challenging to be attempted by amateurs. However, the method introduced by David Crich (Scheme 4), with 4,6-benzylidene protection a prerequisite and anomeric alpha triflate a key intermediate leaves this problem essentially solved. The concurrently developed but rather more protracted intramolecular aglycon delivery (IAD) approach is a little-used but nevertheless stereospecific alternative.
Sources: en.wikipedia.org
Actin-binding proteins (also known as ABPs) are proteins that bind to actin. This may mean ability to bind actin monomers, or polymers, or both. Many actin-binding proteins, including α-actinin, β-spectrin, dystrophin, utrophin and fimbrin, do this through the actin-binding calponin homology domain. This is a list of actin-binding proteins in alphabetical order. 25kDa 25kDa ABP from aorta 30akDA 30bkDa 34kDA 45kDa 110 kD dimer ABP 110 kD (Drebrin) p53 p58gag p185neu p116rip a-actinin Abl ABLIM Actin-Interacting MAPKKK Ssk2p ABP120 ABP140 Abp1p ABP280 (Filamin) ABP50 (EF-1a) Acan 125 (Carmil) ActA Actibind Actin Actinfilin Actinogelin Actin-regulating kinases Actin-Related Proteins Actobindin Actolinkin Actopaxin Actophorin Acumentin (= L-plastin) Adducin ADF/Cofilin Adseverin (scinderin) Afadin AFAP-110 Affixin Aginactin AIP1 Aldolase Angiogenin Anillin Annexins Aplyronine Archvillin (isoform of Supervillin) Arginine kinase Arp2/3 complex Band 4.1 Band 4.9 (Dematin) b-actinin b-Cap73 Bifocal Bistramide A BPAG1 Brevin (Gelsolin)
"Bad and Boujee" is a song by American hip-hop group Migos featuring American rapper Lil Uzi Vert. Written alongside producer Metro Boomin and co-producer G Koop, it was originally released to the Quality Control Music YouTube channel on August 27, 2016 before being officially released on October 28 by Quality Control Music, 300 Entertainment, and Atlantic Records as the lead single from the group's second studio album Culture (2017). In late December 2016, "Bad and Boujee" became an Internet phenomenon, spawning many memes with the lyrics "rain drop, drop top". This viral trend, combined with Donald Glover's shoutout at the 2017 Golden Globes, would help its commercial performance and cause the song to spike into the top ten and later peak at number one on the US Billboard Hot 100 for the week of January 21, 2017, making it the first number one single for both Migos and Lil Uzi Vert. There were also many memes about member Takeoff's omission from the song. The single received a nomination for Best Rap Performance at the 60th Annual Grammy Awards. The track has acquired over 1 billion Spotify plays as of August 2025.
== The Human Growth Hormone, Creutzfeld Jakob Disease Controversy == Wilhelmi was an important researcher involved in harnessing human grown hormone from cadavers in the 1960s and 1970s. Early studies conducted in 1958 by Maurice Raben at Tufts University School of Medicine showed it was possible to cause children with pituitary dwarfism to grow by injecting them with human growth hormone. In 1961, the National Institutes of Health (NIH) formed the National Pituitary Agency to organize collection and redistribution of human endocrine glands to three universities for processing into growth hormone: Emory University, Tufts University and Cornell University. For the first 14 of these years, Wilhelmi supervised the Emory laboratory, which was the largest seat of hormone production. In 1985, however, two patients who previously had received the exogenous hormone treatment died in the United States. That caused the NIH to suspend the human growth hormone program and launch an investigation. The deaths were attributed to Creutzfeldt–Jakob disease (CJD) transmitted by impurities in the hormone injected into the patients years earlier using the Wilhelmi protocol. As of 2000, there had been 22 CJD deaths among American recipients of unfiltered hormone prior to 1977.
The HIE-ISOLDE project introduced a network of High Energy Beam Transfer (HEBT) beamlines to the ISOLDE facility. The common section beamline, XT00, joins to three bending beamlines (XT01, XT02, XT03) leading to different experiment setups. The three identical beamlines are independent of each other, for example, if the first XT01 dipole magnet is off, the beam will continue to the XT02 and XT03. They all bend the beam by 90 degrees and focus it using two dipole magnets and a doublet-quadrupole. The XT01 beamline leads to Miniball, the XT02 beamline leads to the ISS, and the XT03 beamline leads to movable setups, such as the SEC scattering chamber. Offline 2 was recently installed as a mass separator beamline at ISOLDE, with the purpose of satisfying the increased demands on the original offline facility, Offline 1. The facility includes the beamline enclosed in a Faraday cage as well as a laser laboratory and control station. The offline facility is designed for target test studies, and upgraded to include potential for the production and study of molecular ion beams.
Sources: en.wikipedia.org
Liquid chromatography–mass spectrometry is common for identity and purity checks. High-performance liquid chromatography with ultraviolet detection can also be used. Both methods require a suitable reference standard.
The solid is usually kept desiccated at -20 °C or lower and protected from light. Stock solutions are aliquoted to limit freeze–thaw cycles. Aqueous solutions are not generally recommended for long-term storage.
Laws differ by country and by intended use. It is not an approved medicine, and many vendors sell it as a research chemical. Purchasers are responsible for confirming local restrictions.
No. It is an investigational compound without approved therapeutic indications. It is sold for research purposes only in many jurisdictions.